PDB entry 2ek1

View 2ek1 on RCSB PDB site
Description: Crystal structure of RNA-binding motif of human rna-binding protein 12
Class: RNA binding protein
Keywords: RNA recognition motif, dimer, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2007-03-22, released 2008-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM12, KIAA0765
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-92)
    Domains in SCOPe 2.05: d2ek1a_
  • Chain 'B':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM12, KIAA0765
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-91)
    Domains in SCOPe 2.05: d2ek1b_
  • Chain 'C':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM12, KIAA0765
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-92)
    Domains in SCOPe 2.05: d2ek1c_
  • Chain 'D':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM12, KIAA0765
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-91)
    Domains in SCOPe 2.05: d2ek1d_
  • Chain 'E':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM12, KIAA0765
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-92)
    Domains in SCOPe 2.05: d2ek1e_
  • Chain 'F':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM12, KIAA0765
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-92)
    Domains in SCOPe 2.05: d2ek1f_
  • Chain 'G':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM12, KIAA0765
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-91)
    Domains in SCOPe 2.05: d2ek1g_
  • Chain 'H':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM12, KIAA0765
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (Start-88)
      • expression tag (89-92)
    Domains in SCOPe 2.05: d2ek1h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ek1A (A:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek1A (A:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ek1B (B:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek1B (B:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ek1C (C:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek1C (C:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ek1D (D:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek1D (D:)
    gptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataa
    vidlndrpigsrkvklsgp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ek1E (E:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek1E (E:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgps
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ek1F (F:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek1F (F:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgps
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ek1G (G:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek1G (G:)
    tvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataavi
    dlndrpigsrkvklsgp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ek1H (H:)
    gssgssgsssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
    mvafesrdeataavidlndrpigsrkvklsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ek1H (H:)
    ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
    idlndrpigsrkvklsgps