PDB entry 2ejr

View 2ejr on RCSB PDB site
Description: LSD1-tranylcypromine complex
Class: oxidoreductase
Keywords: Tower domain, LSD1, FAD, Tranylcypromine, Parnate, amine oxidase, histone, demethylase, Alternative splicing, Chromatin regulator, Coiled coil, Nucleus, Oxidoreductase, Phosphorylation, Repressor, Transcription, Transcription regulation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-20, released 2008-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific histone demethylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0601, LSD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ejra1, d2ejra2, d2ejra3
  • Heterogens: F2N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ejrA (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpp
    rditaeflvkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildw
    hfanlefanatplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavr
    qvrytasgceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsav
    qrmgfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvagea
    agimenisddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgn
    dydlmaqpitpgpsipgapqpiprlffagehtirnypatvhgallsglreagriadqflg
    am
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejrA (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeditaefl
    vkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildwhfanlefa
    natplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavrqvrytasg
    ceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsavqrmgfgnl
    nkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagimenis
    ddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgndydlmaqp
    itppiprlffagehtirnypatvhgallsglreagriadqflg