PDB entry 2ejp

View 2ejp on RCSB PDB site
Description: Crystal structure of monomeric kusabira-orange (mKO), orange-emitting GFP-like protein, at pH 6.0
Class: luminescent protein
Keywords: GFP-LIKE PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LUMINESCENT PROTEIN
Deposited on 2007-03-20, released 2008-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fluorescent protein
    Species: Fungia concinna
    Gene: mKO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ejpa_
  • Chain 'B':
    Compound: fluorescent protein
    Species: Fungia concinna
    Gene: mKO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ejpb_
  • Chain 'C':
    Compound: fluorescent protein
    Species: Fungia concinna
    Gene: mKO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ejpc_
  • Chain 'D':
    Compound: fluorescent protein
    Species: Fungia concinna
    Gene: mKO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ejpd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ejpA (A:)
    mvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlv
    shvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhk
    skftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfktty
    kaakkilkmpgshyishrlvrktegnitelvedavahslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejpA (A:)
    vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs
    hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks
    kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk
    aakkilkmpgshyishrlvrktegnitelvedavahs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ejpB (B:)
    mvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlv
    shvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhk
    skftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfktty
    kaakkilkmpgshyishrlvrktegnitelvedavahslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejpB (B:)
    vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs
    hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks
    kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk
    aakkilkmpgshyishrlvrktegnitelvedavahs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ejpC (C:)
    mvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlv
    shvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhk
    skftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfktty
    kaakkilkmpgshyishrlvrktegnitelvedavahslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejpC (C:)
    vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs
    hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks
    kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk
    aakkilkmpgshyishrlvrktegnitelvedavahs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ejpD (D:)
    mvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlv
    shvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhk
    skftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfktty
    kaakkilkmpgshyishrlvrktegnitelvedavahslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejpD (D:)
    vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs
    hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks
    kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk
    aakkilkmpgshyishrlvrktegnitelvedavahs