PDB entry 2ejo

View 2ejo on RCSB PDB site
Description: Crystal structure of monomeric kusabira-orange (mKO), orange-emitting GFP-like protein, at pH 9.1
Class: luminescent protein
Keywords: GFP-LIKE PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LUMINESCENT PROTEIN
Deposited on 2007-03-20, released 2008-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.205
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fluorescent protein
    Species: Fungia concinna
    Gene: mKO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ejoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ejoA (A:)
    mvsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlv
    shvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhk
    skftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfktty
    kaakkilkmpgshyishrlvrktegnitelvedavahslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejoA (A:)
    vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs
    hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks
    kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk
    aakkilkmpgshyishrlvrktegnitelvedavahs