PDB entry 2ejn

View 2ejn on RCSB PDB site
Description: Structural characterization of the tetrameric form of the major cat allergen fel D 1
Class: allergen
Keywords: allergen, cat allergen, uteroglobin, secretoglobin
Deposited on 2007-03-19, released 2007-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-06-17, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.19
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major allergen I polypeptide chain 1, chain 2
    Species: Felis catus [TaxId:9685]
    Gene: ch1, ch2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30438 (1-70)
      • initiating methionine (0)
    • Uniprot P30440 (71-End)
    Domains in SCOPe 2.06: d2ejna1, d2ejna2
  • Chain 'B':
    Compound: Major allergen I polypeptide chain 1, chain 2
    Species: Felis catus [TaxId:9685]
    Gene: ch1, ch2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30438 (1-70)
      • initiating methionine (0)
    • Uniprot P30440 (71-End)
    Domains in SCOPe 2.06: d2ejnb1, d2ejnb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ejnA (A:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcmgehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejnA (A:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ejnB (B:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcmgehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejnB (B:)
    meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
    lldkiytsplcvkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcy
    venglisrvldglvmttissskdcm