PDB entry 2ejh

View 2ejh on RCSB PDB site
Description: Crystal structure of Kusabira-Cyan (KCy), a cyan-emitting GFP-like protein
Class: luminescent protein
Keywords: GFP-like protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LUMINESCENT PROTEIN
Deposited on 2007-03-16, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.164
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyan-emitting GFP-like protein, Kusabira-Cyan (KCy)
    Species: Fungia concinna
    Database cross-references and differences (RAF-indexed):
    • PDB 2EJH
    Domains in SCOPe 2.06: d2ejha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ejhA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdptmsvikpemkmkyfmdgsvngheftve
    gegtgkpyegkhkitldvtkggplpfafdllstvfsygnrcltkypddipdyfkqcfpgg
    yswerkfefedgglaiakaeislkgncfehkstiegtfpdsspiaqnktlgwepstekmt
    vrdgsmkgddaaylklvgggnhkcyftttytakkkipnlpqshfighrissvvngtkigv
    medaiahlypfngvpcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejhA (A:)
    msvikpemkmkyfmdgsvngheftvegegtgkpyegkhkitldvtkggplpfafdllstv
    fsygnrcltkypddipdyfkqcfpggyswerkfefedgglaiakaeislkgncfehksti
    egtfpdsspiaqnktlgwepstekmtvrdgsmkgddaaylklvgggnhkcyftttytakk
    kipnlpqshfighrissvvngtkigvmedaiahlypfn