PDB entry 2ejf

View 2ejf on RCSB PDB site
Description: Crystal Structure Of The Biotin Protein Ligase (Mutations R48A and K111A) and Biotin Carboxyl Carrier Protein Complex From Pyrococcus Horikoshii OT3
Class: ligase
Keywords: Biotinylation, Dimer, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-03-16, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: bpl
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • engineered (47)
      • engineered (110)
    Domains in SCOPe 2.07: d2ejfa1, d2ejfa2
  • Chain 'B':
    Compound: 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: bpl
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-End)
      • engineered (47)
      • engineered (110)
    Domains in SCOPe 2.07: d2ejfb1, d2ejfb2
  • Chain 'C':
    Compound: 149aa long hypothetical methylmalonyl-CoA decarboxylase gamma chain
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: bccp
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 149aa long hypothetical methylmalonyl-CoA decarboxylase gamma chain
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: bccp
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BTN, ADN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ejfA (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ejfB (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ejfB (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilfegiaediddfgrliirldsgevkkviygdvs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.