PDB entry 2ejc

View 2ejc on RCSB PDB site
Description: Crystal Structure Of Pantoate--Beta-Alanine Ligase (panC) From Thermotoga maritima
Class: ligase
Keywords: Pantoate-beta-alanine ligase, X-ray Diffraction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-16, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantoate--beta-alanine ligase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: panC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ejca_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ejcA (A:)
mriietieemkkfseemrekkktigfvptmgylheghlslvrraraendvvvvsifvnpt
qfgpnedyeryprdferdrkllekenvdcifhpsveemyppdfstyveetklskhlcgrs
rpghfrgvctvvtklfnivkphrayfgqkdaqqfrvlrrmvrdlnmdvemiecpivrepd
glamssrnvylspeerqqalslyqslkiaenlylngerdaekikeemikhlsrfdkvkid
yveivdeetlepvekidrkvivavaawvgnarlidntilg