PDB entry 2eig

View 2eig on RCSB PDB site
Description: Lotus tetragonolobus seed lectin (Isoform)
Class: sugar binding protein
Keywords: Lotus tetragonolobus, L-fucosyl, N-acetyl-D-glucosamine, SUGAR BINDING PROTEIN
Deposited on 2007-03-13, released 2008-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Lotus tetragonolobus [TaxId:3868]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2EIG (0-End)
    Domains in SCOPe 2.06: d2eiga_
  • Chain 'B':
    Compound: lectin
    Species: Lotus tetragonolobus [TaxId:3868]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2EIG (0-End)
    Domains in SCOPe 2.06: d2eigb_
  • Chain 'C':
    Compound: lectin
    Species: Lotus tetragonolobus [TaxId:3868]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2EIG (0-End)
    Domains in SCOPe 2.06: d2eigc_
  • Chain 'D':
    Compound: lectin
    Species: Lotus tetragonolobus [TaxId:3868]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2EIG (0-End)
    Domains in SCOPe 2.06: d2eigd_
  • Heterogens: NAG, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eigA (A:)
    vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
    sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
    shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
    gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkepeeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eigA (A:)
    vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
    sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
    shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
    gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eigB (B:)
    vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
    sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
    shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
    gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkepeeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eigB (B:)
    vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
    sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
    shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
    gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eigC (C:)
    vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
    sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
    shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
    gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkepeeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eigC (C:)
    vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
    sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
    shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
    gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2eigD (D:)
    vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
    sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
    shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
    gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkepeeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eigD (D:)
    vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
    sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
    shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
    gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkep