PDB entry 2eif

View 2eif on RCSB PDB site
Description: Eukaryotic translation initiation factor 5A from Methanococcus jannaschii
Class: gene regulation
Keywords: EIF-5A, TRANSLATION, OB-FOLD, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, GENE REGULATION
Deposited on 1998-10-12, released 1999-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (eukaryotic translation initiation factor 5a)
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58625 (0-End)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d2eifa1, d2eifa2, d2eifa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eifA (A:)
    mviimpgtkqvnvgslkvgqyvmidgvpceivdisvskpgkhggakarvvgigifekvkk
    efvaptsskvevpiidrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggevey
    ieavgqykitrviggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eifA (A:)
    mviimpgtkqvnvgslkvgqyvmidgvpceivdisvskpgkhggakarvvgigifekvkk
    efvaptsskvevpiidrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggevey
    ieavgqykitrvi