PDB entry 2eie

View 2eie on RCSB PDB site
Description: Crystal Structure of Galactose Oxidase complexed with Azide
Class: oxidoreductase
Keywords: Galactose Oxidase complex with azide, OXIDOREDUCTASE
Deposited on 2007-03-12, released 2007-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose oxidase
    Species: GIBBERELLA ZEAE [TaxId:5518]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2eiea1, d2eiea2, d2eiea3
  • Heterogens: AZI, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eieA (A:)
    asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
    ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
    aryvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgptidlpivpaaaaiepts
    grvlmwssyrndafggspggitltsswdpstgivsdrtvtvtkhdmfcpgismdgngqiv
    vtggndakktslydsssdswipgpdmqvargyqssatmsdgrvftiggswsggvfeknge
    vyspssktwtslpnakvnpmltadkqglyrsdnhawlfgwkkgsvfqagpstamnwyyts
    gsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggspdyqdsdattnahiitlg
    epgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgipfedstpvftpeiyvpeq
    dtfykqnpnsivrvyhsislllpdgrvfngggglcgdcttnhfdaqiftpnylynsngnl
    atrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnnggn
    sysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq