PDB entry 2eic

View 2eic on RCSB PDB site
Description: Crystal Structure of Galactose Oxidase mutant W290F
Class: oxidoreductase
Keywords: Galactose Oxidase W290F mutant
Deposited on 2007-03-12, released 2007-04-24
The last revision prior to the SCOP 1.75 freeze date was dated 2007-04-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.177
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose oxidase
    Species: Gibberella zeae
    Gene: go
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01745 (0-638)
      • engineered (289)
    Domains in SCOP 1.75: d2eica1, d2eica2, d2eica3
  • Heterogens: NA, CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eicA (A:)
    asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
    ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
    aryvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgptidlpivpaaaaiepts
    grvlmwssyrndafggspggitltsswdpstgivsdrtvtvtkhdmfcpgismdgngqiv
    vtggndakktslydsssdswipgpdmqvargyqssatmsdgrvftiggsfsggvfeknge
    vyspssktwtslpnakvnpmltadkqglyrsdnhawlfgwkkgsvfqagpstamnwyyts
    gsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggspdyqdsdattnahiitlg
    epgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgipfedstpvftpeiyvpeq
    dtfykqnpnsivrvyhsislllpdgrvfngggglcgdcttnhfdaqiftpnylynsngnl
    atrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnnggn
    sysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq