PDB entry 2ehu

View 2ehu on RCSB PDB site
Description: Crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound NAD and Inhibitor L-serine
Class: oxidoreductase
Keywords: Enzyme-coenzyme-inhibitor ternary complex, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2007-03-09, released 2007-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.14
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ehua_
  • Chain 'B':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ehub_
  • Heterogens: NA, ACT, SER, NAD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ehuA (A:)
    mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
    psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
    vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
    apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
    eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggkdaiivdet
    adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
    gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
    pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
    gvqpfggfklsgtnaktgaldylrlflemkavaerf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ehuB (B:)
    mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
    psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
    vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
    apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
    eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggkdaiivdet
    adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
    gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
    pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
    gvqpfggfklsgtnaktgaldylrlflemkavaerf