PDB entry 2ehr

View 2ehr on RCSB PDB site
Description: Solution structure of the sixth PDZ domain of human InaD-like protein
Class: structural protein
Keywords: PDZ domain, InaD-like protein, Inadl protein, hINADL, Pals1-associated tight junction protein, Protein associated to tight junctions, INADL, PATJ, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2007-03-07, released 2007-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: InaD-like protein
  Species: Homo sapiens [TaxId:9606]
  Gene: INADL, PATJ
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8NI35 (7-116)
    • expression tag (0-6)
  Domains in SCOPe 2.05: d2ehra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ehrA (A:)
  gssgssgpnfshwgppriveifrepnvslgisivggqtvikrlkngeelkgifikqvled
  spagktnalktgdkilevsgvdlqnashseaveaiknagnpvvfivqslsstprvip