PDB entry 2eh0

View 2eh0 on RCSB PDB site
Description: Solution structure of the FHA domain from human Kinesin-like protein KIF1B
Class: transport protein
Keywords: FHA domain, Kinesin-like protein KIF1B, Klp, KIF1B, KIAA0591, KIAA1448, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
Deposited on 2007-03-02, released 2007-09-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF1B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60333 (7-123)
      • expression tag (0-6)
      • expression tag (124-129)
    Domains in SCOPe 2.05: d2eh0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2eh0A (A:)
gssgssgtphlvnlnedplmsecllyyikdgitrvgqadaerrqdivlsgahikeehcif
rsersnsgevivtlepcersetyvngkrvsqpvqlrsgnriimgknhvfrfnhpeqarae
rektsgpssg