PDB entry 2egm

View 2egm on RCSB PDB site
Description: Solution structure of the zf-B_box domain from human Tripartite motif protein 41
Class: transcription/metal binding protein
Keywords: zf-B_box domain, Tripartite motif protein 41, TRIM41, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION/METAL BINDING PROTEIN COMPLEX
Deposited on 2007-03-01, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tripartite motif-containing protein 41
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM41
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WV44 (7-56)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d2egma1, d2egma2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2egmA (A:)
    gssgssgtpgrgsrvtdqgicpkhqealklfcevdeeaicvvcresrshkqhsvvpl