PDB entry 2ege

View 2ege on RCSB PDB site
Description: Solution structure of the third SH3 domain from human KIAA1666 protein
Class: structural genomics, unknown function
Keywords: SH3 domain, KIAA1666 protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2007-02-28, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein KIAA1666
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA1666
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UFD9 (7-74)
    • expression tag (0-6)
  Domains in SCOPe 2.07: d2egea1, d2egea2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2egeA (A:)
  gssgssgkimiaaldydpgdgqmggqgkgrlalragdvvmvygpmddqgfyygelgghrg
  lvpahlldhmslhgh