PDB entry 2egd

View 2egd on RCSB PDB site
Description: Crystal structure of human S100A13 in the Ca2+-bound state
Class: metal binding protein
Keywords: ef-hand, metal binding protein
Deposited on 2007-02-28, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2egda_
  • Chain 'B':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2egdb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2egdA (A:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2egdA (A:)
    plteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekmksld
    vnqdselkfneywrligelakeirkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2egdB (B:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2egdB (B:)
    lteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekmksldv
    nqdselkfneywrligelakeirkkkdlkir