PDB entry 2ega

View 2ega on RCSB PDB site
Description: Solution structure of the first SH3 domain from human KIAA0418 protein
Class: signaling protein
Keywords: SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-28, released 2007-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and PX domain-containing protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: SH3MD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TCZ1 (7-63)
      • expression tag (0-6)
      • expression tag (64-69)
    Domains in SCOPe 2.05: d2egaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2egaA (A:)
gssgssgleqyvvvsnykkqenselslqagevvdvieknesgwwfvstseeqgwvpatyl
eaqnsgpssg