PDB entry 2eg1

View 2eg1 on RCSB PDB site
Description: The crystal structure of PII protein
Class: signaling protein
Keywords: Nitrogen regulatory protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-27, released 2008-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nitrogen regulatory protein p-II
  Species: Aquifex aeolicus [TaxId:63363]
  Gene: GLNB
  Database cross-references and differences (RAF-indexed):
  • Uniprot O66513 (0-111)
  Domains in SCOPe 2.07: d2eg1a_
• Heterogens: SO4, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2eg1A (A:)
  mkkieaiikpfkldevkdalveigiggmtvtevkgfgqqkghteiyrgteyvidflpkvk
  ievvvrdedvekvvetivktaqtgrvgdgkifiipvedvirirtgergeqai
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2eg1A (A:)
  mkkieaiikpfkldevkdalveigiggmtvtevkgfdflpkvkievvvrdedvekvveti
  vktaqtgrvgdgkifiipvedvirirtgergeqai