PDB entry 2eg0

View 2eg0 on RCSB PDB site
Description: Crystal Structure of Hypothetical Protein(GK2848) from Geobacillus kaustophilus
Class: structural genomics unknown function
Keywords: Hypothetical protein, Geobacillus kaustophilus, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS UNKNOWN FUNCTION
Deposited on 2007-02-27, released 2007-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical conserved protein
    Species: Geobacillus kaustophilus [TaxId:1462]
    Gene: GK2848
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2eg0a_
  • Chain 'B':
    Compound: Hypothetical conserved protein
    Species: Geobacillus kaustophilus [TaxId:1462]
    Gene: GK2848
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2eg0b_
  • Chain 'C':
    Compound: Hypothetical conserved protein
    Species: Geobacillus kaustophilus [TaxId:1462]
    Gene: GK2848
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2eg0c_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eg0A (A:)
    miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn
    silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv
    ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqqrtscadkke
    lp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eg0A (A:)
    miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn
    silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv
    ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eg0B (B:)
    miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn
    silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv
    ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqqrtscadkke
    lp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eg0B (B:)
    miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn
    silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv
    ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eg0C (C:)
    miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn
    silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv
    ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqqrtscadkke
    lp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eg0C (C:)
    miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn
    silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv
    ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqq