PDB entry 2efw

View 2efw on RCSB PDB site
Description: Crystal structure of the RTP:nRB complex from Bacillus subtilis
Class: replication/DNA
Keywords: protein-DNA complex, 'winged'-helix protein, DNA replication termination, replication fork arrest, REPLICATION-DNA COMPLEX
Deposited on 2007-02-26, released 2008-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.293
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication termination protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68732 (Start-121)
      • engineered (109)
    Domains in SCOPe 2.07: d2efwa_
  • Chain 'B':
    Compound: Replication termination protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68732 (Start-121)
      • engineered (109)
    Domains in SCOPe 2.07: d2efwb_
  • Chain 'D':
    Compound: DNA (5'-d(*dcp*dt*dap*dtp*dgp*dtp*dap*dcp*dcp*dap*dap*dap*dtp*dgp*dtp*dtp*dcp*dap*dgp*dtp*dc)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*dgp*dap*dcp*dtp*dgp*dap*dap*dcp*dap*dtp*dtp*dtp*dgp*dgp*dtp*dap*dcp*dap*dtp*dap*dg)-3')
  • Chain 'F':
    Compound: Replication termination protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68732 (Start-121)
      • engineered (109)
    Domains in SCOPe 2.07: d2efwf_
  • Chain 'G':
    Compound: Replication termination protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68732 (Start-121)
      • engineered (109)
    Domains in SCOPe 2.07: d2efwg_
  • Chain 'I':
    Compound: DNA (5'-d(*dcp*dt*dap*dtp*dgp*dtp*dap*dcp*dcp*dap*dap*dap*dtp*dgp*dtp*dtp*dcp*dap*dgp*dtp*dc)-3')
  • Chain 'J':
    Compound: DNA (5'-d(*dgp*dap*dcp*dtp*dgp*dap*dap*dcp*dap*dtp*dtp*dtp*dgp*dgp*dtp*dap*dcp*dap*dtp*dap*dg)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2efwA (A:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efwA (A:)
    stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
    gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2efwB (B:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efwB (B:)
    stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
    gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2efwF (F:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efwF (F:)
    stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
    gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2efwG (G:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efwG (G:)
    stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
    gilkqikvkevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.