PDB entry 2efv

View 2efv on RCSB PDB site
Description: Crystal Structure of a Hypothetical Protein(MJ0366) from Methanocaldococcus jannaschii
Class: structural genomics, unknown function
Keywords: Hypothetical Protein, Methanocaldococcus jannaschii DSM 2661, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2007-02-26, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein MJ0366
  Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
  Gene: mj0366
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57812
  Domains in SCOPe 2.07: d2efva1
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2efvA (A:)
  mplvgfmkekkratfylyknidgrklryllhklenvenvdidtlrraieaekkykrsitl
  teeeeviiqrlgksanlllncelvkldegera
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2efvA (A:)
  fmkekkratfylyknidgrklryllhklenvenvdidtlrraieaekkykrsitlteeee
  viiqrlgksanlllncelvkld