PDB entry 2eft

View 2eft on RCSB PDB site
Description: Methanethiol-CYS 112 inhibition complex of E. coli ketoacyl synthase III (FABH) and Coenzyme A (high concentration (1.7mM) soak)
Class: transferase
Keywords: fatty acid biosynthesis, alkyl-coa-disulfide, mechanism-based inhibitor, e. coli, half sites occupancy, transferase
Deposited on 2007-02-24, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Escherichia coli [TaxId:562]
    Gene: fabH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2efta1, d2efta2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Escherichia coli [TaxId:562]
    Gene: fabH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eftb1, d2eftb2
  • Heterogens: SO4, COA, MEE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eftA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eftB (B:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf