PDB entry 2efq

View 2efq on RCSB PDB site
Description: Crystal Structure of Thr134 to Ala of ST1022-Glutamine Complex from Sulfolobus tokodaii 7
Class: transcription regulator
Keywords: Transcriptional regulator, Lrp/AsnC family Gln binding, ST1022, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION REGULATOR
Deposited on 2007-02-23, released 2008-03-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 150aa long hypothetical transcriptional regulator
  Species: Sulfolobus tokodaii [TaxId:273063]
  Gene: ST1022
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q972W6 (0-149)
    • engineered (133)
  Domains in SCOPe 2.03: d2efqa1, d2efqa2
• Heterogens: MG, GLN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2efqA (A:)
  mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
  ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
  ervmsipevertsaqvvvkiikespnivif