PDB entry 2efo

View 2efo on RCSB PDB site
Description: Crystal structure of Tyr77 to Ala of ST1022 from Sulfolobus tokodaii 7
Class: transcription regulator
Keywords: Transcriptional regulator, Lrp/AsnC family Gln binding, ST1022, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION REGULATOR
Deposited on 2007-02-23, released 2008-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 150aa long hypothetical transcriptional regulator
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST1022
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q972W6 (0-149)
      • engineered (76)
    Domains in SCOPe 2.08: d2efoa1, d2efoa2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2efoA (A:)
    mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
    ldyivitsvkakygknahvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
    ervmsipevertstqvvvkiikespnivif