PDB entry 2efn

View 2efn on RCSB PDB site
Description: Crystal Structure of Ser 32 to Ala of ST1022 from Sulfolobus tokodaii 7
Class: transcription regulator
Keywords: Transcriptional regulator, Lrp/AsnC family Gln binding, ST1022, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION REGULATOR
Deposited on 2007-02-23, released 2008-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 150aa long hypothetical transcriptional regulator
  Species: Sulfolobus tokodaii [TaxId:273063]
  Gene: ST1022
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q972W6 (0-149)
    • engineered (31)
  Domains in SCOPe 2.08: d2efna1, d2efna2
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2efnA (A:)
  mdeidlrilkilqynakysldeiareiripkatlsyrikklekdgvikgyyayinpasln
  ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
  ervmsipevertstqvvvkiikespnivif