PDB entry 2efi

View 2efi on RCSB PDB site
Description: Solution structure of the chromo domain of Mortality factor 4-like protein 1 from human
Class: transcription
Keywords: Chromo domain, Mortality factor 4-like protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-02-22, released 2007-08-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mortality factor 4-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MORF4L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBU8 (7-99)
      • expression tag (0-6)
    Domains in SCOPe 2.02: d2efia1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2efiA (A:)
    gssgssgmapkqdpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknw
    dewvpesrvlkyvdtnlqkqrelqkanqeqyaegkmrgaa