PDB entry 2efi

View 2efi on RCSB PDB site
Description: Solution structure of the chromo domain of Mortality factor 4-like protein 1 from human
Class: transcription
Keywords: Chromo domain, Mortality factor 4-like protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-02-22, released 2007-08-28
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-28, with a file datestamp of 2007-08-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mortality factor 4-like protein 1
  Species: HOMO SAPIENS
  Gene: MORF4L1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBU8 (7-99)
    • expression tag (0-6)
  Domains in SCOP 1.75: d2efia1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2efiA (A:)
  gssgssgmapkqdpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknw
  dewvpesrvlkyvdtnlqkqrelqkanqeqyaegkmrgaa