PDB entry 2efg

View 2efg on RCSB PDB site
Description: translational elongation factor g complexed with GDP
Class: protein binding
Keywords: elongation factor, translocase, ribosome, elongation, translation, protein synt factor, gtpase, GTP binding, guanosine nucleotide binding,, protein binding
Deposited on 1998-09-23, released 1999-09-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (elongation factor g)
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13551
      • conflict (207)
    Domains in SCOPe 2.01: d2efga1, d2efga2, d2efga3, d2efga4
  • Chain 'B':
    Compound: protein (elongation factor g domain 3)
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2EFG (0-87)
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2efgA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldnareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2efgA (A:)
    ydlkrlrnigiaahidagktttterilyytgriaavttcfwkdhriniidtpghvdftie
    versmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirtm
    qerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldnareyh
    eklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqlll
    davvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysg
    tltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvged
    aprvilesvgkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvn
    aivggvipkeyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiags
    maikeavqkgdpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafv
    plaemfgyatdlrsktqgrgsfvmffdhyqevpkqvqeklik
    

  • Chain 'B':
    No sequence available.