PDB entry 2eek

View 2eek on RCSB PDB site
Description: Crystal structure of Atlantic cod trypsin complexed with benzamidine
Class: hydrolase
Keywords: benzamidine inhibited, HYDROLASE
Deposited on 2007-02-15, released 2008-02-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin-1
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2eeka_
  • Heterogens: CA, NA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eekA (A:)
    ivggyectkhsqahqvslnsgyhfcggslvskdwvvsaahcyksvlrvrlgehhirvneg
    teqyissssvirhpnyssyninndimlikltkpatlnqyvhavalptecaadatmctvsg
    wgntmssvadgdklqclslpilshadcansypgmitqsmfcagyleggkdscqgdsggpv
    vcngvlqgvvswgygcaerdhpgvyakvcvlsgwvrdtma