PDB entry 2ee8

View 2ee8 on RCSB PDB site
Description: Solution structure of three zf-C2H2 domains from mouse protein odd-skipped-related 2 splicing isoform 2
Class: gene regulation
Keywords: zinc binding, zf-C2H2 domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2007-02-15, released 2007-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein odd-skipped-related 2
    Species: Mus musculus [TaxId:10090]
    Gene: Osr2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91ZD1 (7-99)
      • expression tag (0-6)
      • see remark 999 (98)
      • expression tag (100-105)
    Domains in SCOPe 2.08: d2ee8a2, d2ee8a3, d2ee8a4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ee8A (A:)
gssgssggrlpsktkkefickfcgrhftksynlliherthtderpytcdichkafrrqdh
lrdhryihskekpfkcqecgkgfcqsrtlavhktlhmqtssptaas