PDB entry 2ee2

View 2ee2 on RCSB PDB site
Description: Solution structures of the fn3 domain of human contactin 1
Class: signaling protein
Keywords: Neural cell surface protein F3, Glycoprotein gp135, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-15, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Contactin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CNTN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12860 (7-112)
      • expression tag (0-6)
      • expression tag (113-118)
    Domains in SCOPe 2.07: d2ee2a1, d2ee2a2, d2ee2a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ee2A (A:)
gssgssgvavinsaqdapseaptevgvkvlssseisvhwehvlekivesyqirywaahdk
eeaanrvqvtsqeysarlenllpdtqyfievgacnsagcgppsdmieaftkkasgpssg