PDB entry 2edr

View 2edr on RCSB PDB site
Description: Solution structure of the ig-like domain (3361-3449) of human obscurin
Class: contractile protein
Keywords: Obscurin-myosin light chain kinase, Obscurin-MLCK, Obscurin-RhoGEF, beta sandwich, ig-fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2007-02-14, released 2007-08-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Obscurin
    Species: Homo sapiens [TaxId:9606]
    Gene: OBSCN, KIAA1556, KIAA1639
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VST9 (7-95)
      • cloning artifact (0-6)
      • cloning artifact (96-101)
    Domains in SCOPe 2.05: d2edra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2edrA (A:)
    gssgssgpahfigrlrhqesiegatatlrcelskaapvewrkgreslrdgdrhslrqdga
    vcelqicglavadageyscvcgeertsatltvkalpsgpssg