PDB entry 2edq

View 2edq on RCSB PDB site
Description: Solution structure of the ig-like domain (3713-3806) of human obscurin
Class: contractile protein
Keywords: Obscurin-myosin light chain kinase, Obscurin-MLCK, Obscurin-RhoGEF, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2007-02-14, released 2007-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Obscurin
  Species: Homo sapiens [TaxId:9606]
  Gene: OBSCN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5VST9 (7-100)
    • cloning artifact (0-6)
    • cloning artifact (101-106)
  Domains in SCOPe 2.08: d2edqa1, d2edqa2, d2edqa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2edqA (A:)
  gssgssgpskfieglrneeategdtatlwcelskaapvewrkghetlrdgdrhslrqdgs
  rcelqirglavvdageyscvcgqertsatltvralparfiesgpssg