PDB entry 2edn

View 2edn on RCSB PDB site
Description: Solution structure of the first ig-like domain from human Myosin-binding protein C, fast-type
Class: contractile protein
Keywords: beta-sandwich, ig-fold, Fast MyBP-C, C-protein, skeletal muscle fast isoform, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2007-02-14, released 2007-08-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, fast-type
    Species: Homo sapiens [TaxId:9606]
    Gene: MYBPC2, MYBPCF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14324 (7-117)
      • cloning artifact (0-6)
    Domains in SCOPe 2.04: d2edna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ednA (A:)
    gssgssgaeeptgvflkkpdsvsvetgkdavvvakvngkelpdkptikwfkgkwlelgsk
    sgarfsfkeshnsasnvytvelhigkvvlgdrgyyrlevkakdtcdscgfnidveapr