PDB entry 2edj

View 2edj on RCSB PDB site
Description: Solution structure of the fifth ig-like domain from human Roundabout homolog 2
Class: cell adhesion
Keywords: KIAA1568 protein, beta sandwich, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2007-02-14, released 2007-08-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Roundabout homolog 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HCK4 (7-99)
    • cloning artifact (0-6)
  Domains in SCOPe 2.05: d2edja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2edjA (A:)
  gssgssgppiilqgpanqtlavdgtallkckatgdplpviswlkegftfpgrdpratiqe
  qgtlqiknlrisdtgtytcvatsssgetswsavldvtesg