PDB entry 2edi

View 2edi on RCSB PDB site
Description: Solution structure of the UQ_con domain from human NEDD8-conjugating enzyme NCE2
Class: ligase
Keywords: non-proline cis peptide bond, E2 Conjugating Enzyme, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-02-14, released 2007-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD8-conjugating enzyme UBE2F
    Species: Homo sapiens [TaxId:9606]
    Gene: NCE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969M7 (7-166)
      • expression tag (0-6)
      • expression tag (167-172)
    Domains in SCOPe 2.08: d2edia1, d2edia2, d2edia3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ediA (A:)
    gssgssgstrrvsvrdkllvkevaeleanlpctckvhfpdpnklhcfqltvtpdegyyqg
    gkfqfetevpdaynmvppkvkcltkiwhpnitetgeiclsllrehsidgtgwaptrtlkd
    vvwglnslftdllnfddplnieaaehhlrdkedfrnkvddyikryarsgpssg