PDB entry 2ed7

View 2ed7 on RCSB PDB site
Description: Solution structure of the first fibronectin type III domain of human Netrin receptor DCC
Class: apoptosis
Keywords: Tumor suppressor protein DCC, Colorectal cancer suppressor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, APOPTOSIS
Deposited on 2007-02-14, released 2008-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Netrin receptor DCC
    Species: Homo sapiens [TaxId:9606]
    Gene: DCC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43146 (7-112)
      • expression tag (0-6)
      • expression tag (113-118)
    Domains in SCOPe 2.06: d2ed7a1, d2ed7a2, d2ed7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ed7A (A:)
gssgssgkpaipsssvlpsaprdvvpvlvssrfvrlswrppaeakgniqtftvffsregd
nreralnttqpgslqltvgnlkpeamytfrvvaynewgpgessqpikvatqpesgpssg