PDB entry 2ed6

View 2ed6 on RCSB PDB site
Description: Crystal Structure of Envelope Protein VP28 from White Spot Syndrome Virus (WSSV)
Class: viral protein
Keywords: beta barrel, N-terminal helix protruding region, VIRAL PROTEIN
Deposited on 2007-02-14, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.248
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6a1
  • Chain 'B':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6b_
  • Chain 'C':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6c_
  • Chain 'D':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6d_
  • Chain 'E':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6e_
  • Chain 'F':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6f_
  • Chain 'G':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6g_
  • Chain 'H':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6h_
  • Chain 'I':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6i_
  • Chain 'J':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6j_
  • Chain 'K':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6k_
  • Chain 'L':
    Compound: 25kDa structural protein VP25
    Species: White spot syndrome virus 1 [TaxId:92652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ed6l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6A (A:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6B (B:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6C (C:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6D (D:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6E (E:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6F (F:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6G (G:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6H (H:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6I (I:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6J (J:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6K (K:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed6L (L:)
    tvtktiethtdnietnmdenlripvtaevgsgyfkmtdvsfdsdtlgkikirngksdaqm
    keedadlvitpvegralevtvgqnltfegtfkvwnntsrkinitgmqmvpkinpskafvg
    ssntssftpvsidedevgtfvcgttfgapiaataggnlfdmyvhvtysgt