PDB entry 2ed1

View 2ed1 on RCSB PDB site
Description: Solution structure of the SH3 domain of 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein
Class: signaling protein
Keywords: GTPase activation, Membrane, Metal-binding, SH3 domain, Zinc-finger, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-14, released 2008-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DDEF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULH1 (7-69)
      • expression tag (0-6)
      • expression tag (70-75)
    Domains in SCOPe 2.06: d2ed1a1, d2ed1a2, d2ed1a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed1A (A:)
    gssgssgnkvrrvktiydcqadnddeltfiegeviivtgeedqewwighiegqperkgvf
    pvsfvhilsdsgpssg