PDB entry 2ed0

View 2ed0 on RCSB PDB site
Description: Solution structure of the SH3 domain of Abl interactor 2 (Abelson interactor 2)
Class: signaling protein
Keywords: Coiled coil, Cytoskeleton, Nuclear protein, Phosphorylation, SH3 domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-14, released 2008-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abl interactor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NYB9 (7-71)
      • expression tag (0-6)
      • expression tag (72-77)
    Domains in SCOPe 2.06: d2ed0a1, d2ed0a2, d2ed0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ed0A (A:)
    gssgssgdppwaprsylekvvaiydytkdkedelsfqegaiiyvikknddgwyegvmngv
    tglfpgnyvesisgpssg