PDB entry 2ecs

View 2ecs on RCSB PDB site
Description: Lambda Cro mutant Q27P/A29S/K32Q at 1.4 A in space group C2
Class: transcription
Keywords: Transcription factor, helix-turn-helix, bacteriophage, flexibility, TRANSCRIPTION
Deposited on 2007-02-14, released 2008-01-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.141
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phage lambda Cro
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: cro
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03040 (0-End)
      • engineered (26)
      • engineered (28)
      • engineered (31)
    Domains in SCOPe 2.01: d2ecsa_
  • Chain 'B':
    Compound: Phage lambda Cro
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: cro
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03040 (0-End)
      • engineered (26)
      • engineered (28)
      • engineered (31)
    Domains in SCOPe 2.01: d2ecsb_
  • Heterogens: SO4, ACT, CL, LI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ecsA (A:)
    meqritlkdyamrfgqtktakdlgvypssinqaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ecsA (A:)
    meqritlkdyamrfgqtktakdlgvypssinqaihagrkifltinadgsvyaeevkpfps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ecsB (B:)
    meqritlkdyamrfgqtktakdlgvypssinqaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ecsB (B:)
    meqritlkdyamrfgqtktakdlgvypssinqaihagrkifltinadgsvyaeevkpfps