PDB entry 2eck

View 2eck on RCSB PDB site
Description: structure of phosphotransferase
Class: transferase
Keywords: transferase, kinase, ATP-binding, phosphotransferase
Deposited on 1996-12-16, released 1997-03-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-01-13, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: ADK+
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ecka1, d2ecka2
  • Chain 'B':
    Compound: adenylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: ADK+
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2eckb1, d2eckb2
  • Heterogens: AMP, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eckA (A:)
    mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eckB (B:)
    mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg