PDB entry 2eck

View 2eck on RCSB PDB site
Description: structure of phosphotransferase
Deposited on 1996-12-16, released 1997-03-12
The last revision prior to the SCOP 1.61 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eckA (A:)
    mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eckB (B:)
    mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg