PDB entry 2ecd

View 2ecd on RCSB PDB site
Description: Solution structure of the human ABL2 SH2 domain
Class: signaling protein
Keywords: SH2 domain, Phosphotyrosine binding domain, Protein Tyrosine Kinase, Signal Transduction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-13, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42684 (7-112)
      • expression tag (0-6)
      • expression tag (113-118)
    Domains in SCOPe 2.07: d2ecda1, d2ecda2, d2ecda3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ecdA (A:)
    gssgssgtpvnslekhswyhgpvsrsaaeyllsslingsflvresesspgqlsislryeg
    rvyhyrinttadgkvyvtaesrfstlaelvhhhstvadglvttlhypapkcnksgpssg