PDB entry 2ecc

View 2ecc on RCSB PDB site
Description: Solution Structure of the second Homeobox Domain of Human Homeodomain Leucine Zipper-Encoding Gene (Homez)
Class: DNA binding protein
Keywords: homeobox domain, transcription factor, Homez, leucine zipper- containing factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2007-02-13, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Homeobox and leucine zipper protein Homez
  Species: Homo sapiens [TaxId:9606]
  Gene: HOMEZ, KIAA1443
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8IX15 (7-69)
    • cloning artifact (0-6)
    • cloning artifact (70-75)
  Domains in SCOPe 2.08: d2ecca2, d2ecca3, d2ecca4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eccA (A:)
  gssgssgkrktkeqlailksfflqcqwarredyqkleqitglprpeiiqwfgdtryalkh
  gqlkwfrdnasgpssg