PDB entry 2ec7

View 2ec7 on RCSB PDB site
Description: Solution Structure of Human Immunodificiency Virus Type-2 Nucleocapsid Protein
Class: viral protein
Keywords: nucleocapsid protein, hiv-2, RNA recognition, zinc finger, viral protein
Deposited on 2007-02-10, released 2008-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gag polyprotein (Pr55Gag)
    Species: Human immunodeficiency virus 2 [TaxId:11717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ec7a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ec7A (A:)
    aqqrkvircwncgkeghsarqcraprrqgcwkcgktghvmakcperqag