PDB entry 2ec5

View 2ec5 on RCSB PDB site
Description: Crystal structures reveal a thiol-protease like catalytic triad in the C-terminal region of Pasteurella multocida toxin
Class: toxin
Keywords: Pasteurella multocida toxin, Cys1159Ser mutant, inactivated mutant
Deposited on 2007-02-09, released 2007-03-06
The last revision prior to the SCOP 1.75 freeze date was dated 2007-04-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.235
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dermonecrotic toxin
    Species: Pasteurella multocida
    Gene: toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17452 (Start-745)
      • engineered (619)
    Domains in SCOP 1.75: d2ec5a1, d2ec5a2, d2ec5a3
  • Chain 'B':
    Compound: Dermonecrotic toxin
    Species: Pasteurella multocida
    Gene: toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17452 (Start-745)
      • engineered (619)
    Domains in SCOP 1.75: d2ec5b1, d2ec5b2, d2ec5b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ec5A (A:)
    mghhhhhhdydipttenlyfqgahmgiqrvsnakllggspyspfriglegvwtpevlkar
    asvigkpigesykrilaklqrihnsnilderqglmhelmelidlyeesqpsserlnafre
    lrtqlekalylpemealkkqilqipnkgsgaarfllrtamnemagktsestadlirfalq
    dtvisapfrgyagaipeaidfpvkyviedisvfdkiqtnywelpayeswnegsnsallpg
    llresqskgmlskcriienslyighsyeemfysispysnqvggpyelypftffsmlqevq
    gdlgfeqafatrnffntlvsdrlslmentmlltesfdytpwdaiygdinydeqfaamsin
    eriekcmntyrgvafqnssksidfflnnlttfidnglteiaisdlpydivqqeisqflqg
    snewktldamlfnldkgdingafrkllqsakdnnikfraighsdnsvppfnnpykslyyk
    gniiaeaiekldregqkfvvfadssllnstpgtgrpmpglvqylkipatvvdsdgawqfl
    pdvassrvpievtelenwqvltppqgkilglkqfkltagfpteqsrlpllensvsedlre
    elmqkidaikndvkmnslvsmeagscdsvspkvaarlkdmgleagmgasitwwrreggme
    fshqmhttasfkfagkefavdashlqfvhdqldttililpvddwaleiaqrnrainpfve
    yvsktgnmlalfmpplftkprltral
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ec5A (A:)
    lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm
    helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl
    lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk
    iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis
    pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes
    fdytpwdaiygdinydeqfaamsineriekcmntyrgvafqnssksidfflnnlttfidn
    glteiaisdlpydivqqeisqflqgsnewktldamlfnldkgdingafrkllqsakdnni
    kfraighsdnsvppfnnpykslyykgniiaeaiekldregqkfvvfadssllnstpgtgr
    pmpglvqylkipatvvdsdgawqflpdvassrvpievtelenwqvltppqgkilglkqfk
    ltagfpteqsrlpllensvsedlreelmqkidaikndvkmnslvsmeagscdsvspkvaa
    rlkdmgleagmgasitwwrreggmefshqmhttasfkfagkefavdashlqfvhdqldtt
    ililpvddwaleiaqrnrainpfveyvsktgnmlalfmpplftkprltral
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ec5B (B:)
    mghhhhhhdydipttenlyfqgahmgiqrvsnakllggspyspfriglegvwtpevlkar
    asvigkpigesykrilaklqrihnsnilderqglmhelmelidlyeesqpsserlnafre
    lrtqlekalylpemealkkqilqipnkgsgaarfllrtamnemagktsestadlirfalq
    dtvisapfrgyagaipeaidfpvkyviedisvfdkiqtnywelpayeswnegsnsallpg
    llresqskgmlskcriienslyighsyeemfysispysnqvggpyelypftffsmlqevq
    gdlgfeqafatrnffntlvsdrlslmentmlltesfdytpwdaiygdinydeqfaamsin
    eriekcmntyrgvafqnssksidfflnnlttfidnglteiaisdlpydivqqeisqflqg
    snewktldamlfnldkgdingafrkllqsakdnnikfraighsdnsvppfnnpykslyyk
    gniiaeaiekldregqkfvvfadssllnstpgtgrpmpglvqylkipatvvdsdgawqfl
    pdvassrvpievtelenwqvltppqgkilglkqfkltagfpteqsrlpllensvsedlre
    elmqkidaikndvkmnslvsmeagscdsvspkvaarlkdmgleagmgasitwwrreggme
    fshqmhttasfkfagkefavdashlqfvhdqldttililpvddwaleiaqrnrainpfve
    yvsktgnmlalfmpplftkprltral
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ec5B (B:)
    lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm
    helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl
    lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk
    iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis
    pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes
    fdytpwdaiygdinydeqfaamsineriekcmntyrgvafqnssksidfflnnlttfidn
    glteiaisdlpydivqqeisqflqgsnewktldamlfnldkgdingafrkllqsakdnni
    kfraighsdnsvppfnnpykslyykgniiaeaiekldregqkfvvfadssllnstpgtgr
    pmpglvqylkipatvvdsdgawqflpdvassrvpievtelenwqvltppqgkilglkqfk
    ltagfpteqsrlpllensvsedlreelmqkidaikndvkmnslvsmeagscdsvspkvaa
    rlkdmgleagmgasitwwrreggmefshqmhttasfkfagkefavdashlqfvhdqldtt
    ililpvddwaleiaqrnrainpfveyvsktgnmlalfmpplftkprltral