PDB entry 2ebz

View 2ebz on RCSB PDB site
Description: Solution structure of the RGS domain from human Regulator of G-protein signaling 12 (RGS12)
Class: signaling protein
Keywords: RGS domain, Regulator of G-protein signaling 12, RGS12, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-09, released 2008-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of G-protein signaling 12
  Species: Homo sapiens [TaxId:9606]
  Gene: RGS12
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14924 (7-154)
    • expression tag (0-6)
  Domains in SCOPe 2.07: d2ebza1, d2ebza2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ebzA (A:)
  gssgssgrerrvaswavsferllqdpvgvryfsdflrkefseenilfwqaceyfnhvpah
  dkkelsyrareifskflcskattpvnidsqaqladdvlraphpdmfkeqqlqifnlmkfd
  sytrflksplyqecilaevegralpdsqqvpsspa